PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC11G05200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 436aa    MW: 45737 Da    PI: 8.1716
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC11G05200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.21.1e-18368401134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      Cs+Cgt++Tp+WR gpdg+ tLCnaCG++ +  +
  OPUNC11G05200.1 368 CSHCGTSETPQWRMGPDGPGTLCNACGIRSKMDR 401
                      *****************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011413.231362400IPR000679Zinc finger, GATA-type
SMARTSM004014.7E-17362412IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.23E-14364425No hitNo description
Gene3DG3DSA:3.30.50.102.0E-15366401IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.92E-17367423No hitNo description
PfamPF003201.8E-16368402IPR000679Zinc finger, GATA-type
PROSITE patternPS003440368393IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MPKPTSSSSS SFLDLAGDVD GDDDSWCPFE GLCCPDDPLD QVLNFDSSVF GHGFFDSLDV  60
ELFPPRGPSG GGGRGGAGEV DSNGAVEHVA FGSSAAESEL GGGAGSEVSV PGGGGRGRGR  120
GEDYALTKSV GVEDMEAEAL DVKPVVRVGV SGAMGAHVAG VFPESKLPLP WPCAVGAGAG  180
ASGMSAPGAV PDNRLLALPD VRFDALTAEA AAPGGERGMT TRDAVSKNRL PTLPGVRSAT  240
PTAPPATPFR WEWEHAAAPS SSVTTTPSDS SLSSPRSLTS VFPRIARVFP SRTAPRRRRS  300
PRRQQWSLIC PLHLVPVAAT AARGKNISHL NAATDGAAFI GDDGGGGSYH RRVVGRQRNR  360
QVRKDRRCSH CGTSETPQWR MGPDGPGTLC NACGIRSKMD RLLPEYRPST SPSFNGDEHS  420
NRHRKVLKLR EKKVRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126191e-168CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0MDB40.0A0A0E0MDB4_ORYPU; Uncharacterized protein
STRINGORGLA11G0198500.11e-171(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127772434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-20GATA transcription factor 7